General Information

  • ID:  hor006402
  • Uniprot ID:  P13085
  • Protein name:  Osteostatin
  • Gene name:  Pthlh
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Parathyroid hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001501 skeletal system development; GO:0001958 endochondral ossification; GO:0002062 chondrocyte differentiation; GO:0002076 osteoblast development; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007492 endoderm development; GO:0008284 positive regulation of cell population proliferation; GO:0010468 regulation of gene expression; GO:0016485 protein processing; GO:0030282 bone mineralization; GO:0032330 regulation of chondrocyte differentiation; GO:0032331 negative regulation of chondrocyte differentiation; GO:0043129 surfactant homeostasis; GO:0048286 lung alveolus development; GO:0060487 lung epithelial cell differentiation; GO:0060649 mammary gland bud elongation; GO:0060659 nipple sheath formation; GO:0061182 negative regulation of chondrocyte development
  • GO CC:  GO:0005576 extracellular region; GO:0005634 nucleus; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  TRSAWPGTTGSGLLEDPQPHTSPTSTSLEPSSR
  • Length:  33(143-175)
  • Propeptide:  MLRRLVQQWSVLVFLLSYSVPSRGRSVEGLGRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRREQEKKKRRTRSAWPGTTGSGLLEDPQPHTSPTSTSLEPSSRTH
  • Signal peptide:  MLRRLVQQWSVLVFLLSYSVPSRG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interaction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P13085-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006402_AF2.pdbhor006402_ESM.pdb

Physical Information

Mass: 400958 Formula: C145H229N43O54
Absent amino acids: CFIKMNVY Common amino acids: S
pI: 5.55 Basic residues: 3
Polar residues: 16 Hydrophobic residues: 5
Hydrophobicity: -99.7 Boman Index: -7988
Half-Life / Aliphatic Index: 7.2 hour Aliphatic Index: 38.48
Instability Index: 6975.15 Extinction Coefficient cystines: 5500
Absorbance 280nm: 171.88

Literature

  • PubMed ID:  3175653
  • Title:  Expression of a calcium-mobilizing parathyroid hormone-like peptide in lactating mammary tissue.
  • PubMed ID:  2747658
  • Title:  Rat parathyroid hormone-like peptide: comparison with the human homologue and expression in malignant and normal tissue.
  • PubMed ID:  2342478
  • Title:  Gene-encoding parathyroid hormone-l